PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB07G27370.1
Common NameLOC102708632
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YA
Protein Properties Length: 311aa    MW: 34355.9 Da    PI: 8.1528
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB07G27370.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.11.3e-32152208158
     CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                   +ep++VNaKQy++Il+RRq Rakle+++kl  k+rkpylheSRh+hA++R+RgsgGrF
  OB07G27370.1 152 EEPIFVNAKQYHAILRRRQIRAKLEAQNKL-VKGRKPYLHESRHRHAMKRARGSGGRF 208
                   69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.5E-37150211IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.238151211IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.4E-27153208IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.8E-24154176IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860156176IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.8E-24185208IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MLTLLREMED HRVHAMPDYD FFSEDHQMKQ LGNKMYDQDS PSSNSGQSHQ EESAMNDSSP  60
NERHTSTQSD NDDDHQKQDQ DKTKSISSLG NPGAAFLPPT LNYSQSFACI PYTADAYYGG  120
VFNGYASHAI VHPQQNGTTN SRMPLPVEPA AEEPIFVNAK QYHAILRRRQ IRAKLEAQNK  180
LVKGRKPYLH ESRHRHAMKR ARGSGGRFLN TKQLEEQKQQ EEEASGGASS TKAPGNRASC  240
LQSGPGCTPP SASAPSEPAS VSASREMLGN HEQNHLPPAG FRPTMGFRAQ NAGDGKLVAN  300
NAMHQRVSMM R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A8e-23152213263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1192201RHRHAMKRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006657945.10.0PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_015694840.10.0PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
TrEMBLJ3MMV50.0J3MMV5_ORYBR; Uncharacterized protein
STRINGOB07G27370.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.17e-40nuclear factor Y, subunit A6